Peptides and Proteins¶
Amino Acid Sequences¶
The AASequence class handles amino acid sequences in OpenMS. A string of
amino acid residues can be turned into a instance of AASequence to provide
some commonly used operations and data. The implementation supports
mathematical operations like addition or subtraction. Also, average and mono
isotopic weight and isotope distributions are accessible.
Weights, formulas and isotope distribution can be calculated depending on the charge state (additional proton count in case of positive ions) and ion type. Therefore, the class allows for a flexible handling of amino acid strings.
A very simple example of handling amino acid sequence with AASequence is given
in the next few lines, which also calculates the weight of the (M) and (M+2H)2+
ions.
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 | from pyopenms import *
seq = AASequence.fromString("DFPIANGER")
prefix = seq.getPrefix(4)
suffix = seq.getSuffix(5)
concat = seq + seq
print(seq.toString())
print(concat.toString())
print(suffix.toString())
seq.getMonoWeight() # weight of M
seq.getMonoWeight(Residue.ResidueType.Full, 2) # weight of M+2H
mz = seq.getMonoWeight(Residue.ResidueType.Full, 2) / 2.0 # m/z of M+2H
concat.getMonoWeight()
print("Monoisotopic m/z of (M+2H)2+ is", mz)
|
Which will produce
DFPIANGER
DFPIANGERDFPIANGER
ANGER
Monoisotopic m/z of (M+2H)2+ is 509.751258535
Molecular Formula¶
Note howe we can easily calculate the charged weight of a (M+2H)2+ ion on line 11
and compute m/z on line 12 – simply dividing by the charge.
We can now combine our knowledge of AASequence with what we learned above
about EmpiricalFormula to get accurate mass and isotope distributions from
the amino acid sequence:
1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 | seq_formula = seq.getFormula()
print("Peptide", seq.toString(), "has molecular formula", seq_formula.toString())
print("="*35)
isotopes = seq_formula.getIsotopeDistribution( CoarseIsotopePatternGenerator(6) )
for iso in isotopes.getContainer():
print ("Isotope", iso.getMZ(), ":", iso.getIntensity())
suffix = seq.getSuffix(3) # y3 ion "GER"
print("="*35)
print("y3 ion :", suffix.toString())
y3_formula = suffix.getFormula(Residue.ResidueType.YIon, 2) # y3++ ion
suffix.getMonoWeight(Residue.ResidueType.YIon, 2) / 2.0 # CORRECT
suffix.getMonoWeight(Residue.ResidueType.XIon, 2) / 2.0 # CORRECT
suffix.getMonoWeight(Residue.ResidueType.BIon, 2) / 2.0 # INCORRECT
print("y3 mz :", suffix.getMonoWeight(Residue.ResidueType.YIon, 2) / 2.0 )
print(y3_formula.toString())
print(seq_formula.toString())
|
Which will produce
Peptide DFPIANGER has molecular formula C44H67N13O15
===================================
Isotope 1017.48796414 : 0.568165123463
Isotope 1018.49131898 : 0.305291324854
Isotope 1019.49467381 : 0.0980210453272
Isotope 1020.49802865 : 0.0232920628041
Isotope 1021.50138349 : 0.00449259625748
Isotope 1022.50473833 : 0.000737829308491
===================================
y3 ion : GER
y3 mz : 181.09514385
C13H24N6O6
C44H67N13O15
Note on lines 13 to 15 we need to remember that we are dealing with an ion of the x/y/z series since we used a suffix of the original peptide and using any other ion type will produce a different mass-to-charge ratio (and while “GER” would also be a valid “x3” ion, note that it cannot be a valid ion from the a/b/c series and therefore the mass on line 15 cannot refer to the same input peptide “DFPIANGER” since its “b3” ion would be “DFP” and not “GER”).
Modified Sequences¶
The AASequence class can also handle modifications,
modifications are specified using a unique string identifier present in the
ModificationsDB in round brackets after the modified amino acid or by providing
the mass of the residue in square brackets. For example
AASequence.fromString(".DFPIAM(Oxidation)GER.") creates an instance of the
peptide “DFPIAMGER” with an oxidized methionine. There are multiple ways to specify modifications, and
AASequence.fromString("DFPIAM(UniMod:35)GER"),
AASequence.fromString("DFPIAM[+16]GER") and
AASequence.fromString("DFPIAM[147]GER") are all equivalent).
from pyopenms import *
seq = AASequence.fromString("PEPTIDESEKUEM(Oxidation)CER")
print(seq.toUnmodifiedString())
print(seq.toString())
print(seq.toUniModString())
print(seq.toBracketString())
print(seq.toBracketString(False))
print(AASequence.fromString("DFPIAM(UniMod:35)GER").toString())
print(AASequence.fromString("DFPIAM[+16]GER").toString())
print(AASequence.fromString("DFPIAM[+15.99]GER").toString())
print(AASequence.fromString("DFPIAM[147]GER").toString())
print(AASequence.fromString("DFPIAM[147.035405]GER").toString())
The above code outputs:
PEPTIDESEKUEMCER
PEPTIDESEKUEM(Oxidation)CER
PEPTIDESEKUEM(UniMod:35)CER
PEPTIDESEKUEM[147]CER
PEPTIDESEKUEM[147.0354000171]CER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
DFPIAM(Oxidation)GER
Note there is a subtle difference between
AASequence.fromString(".DFPIAM[+16]GER.") and
AASequence.fromString(".DFPIAM[+15.9949]GER.") - while the former will try to
find the first modification matching to a mass difference of 16 +/- 0.5, the
latter will try to find the closest matching modification to the exact mass.
The exact mass approach usually gives the intended results while the first
approach may or may not.
N- and C-terminal modifications are represented by brackets to the right of the dots
terminating the sequence. For example, ".(Dimethyl)DFPIAMGER." and
".DFPIAMGER.(Label:18O(2))" represent the labelling of the N- and C-terminus
respectively, but ".DFPIAMGER(Phospho)." will be interpreted as a
phosphorylation of the last arginine at its side chain:
from pyopenms import *
s = AASequence.fromString(".(Dimethyl)DFPIAMGER.")
print(s.toString(), s.hasNTerminalModification())
s = AASequence.fromString(".DFPIAMGER.(Label:18O(2))")
print(s.toString(), s.hasCTerminalModification())
s = AASequence.fromString(".DFPIAMGER(Phospho).")
print(s.toString(), s.hasCTerminalModification())
Arbitrary/unknown amino acids (usually due to an unknown modification) can be
specified using tags preceded by X: “X[weight]”. This indicates a new amino
acid (“X”) with the specified weight, e.g. "RX[148.5]T". Note that this tag
does not alter the amino acids to the left (R) or right (T). Rather, X
represents an amino acid on its own. Be careful when converting such AASequence
objects to an EmpiricalFormula using getFormula(), as tags will not be
considered in this case (there exists no formula for them). However, they have
an influence on getMonoWeight() and getAverageWeight()!
Proteins¶
Protein sequences can be accessed through the FASTAEntry object and can be
read and stored on disk using a FASTAFile:
from pyopenms import *
bsa = FASTAEntry()
bsa.sequence = "MKWVTFISLLLLFSSAYSRGVFRRDTHKSEIAHRFKDLGE"
bsa.description = "BSA Bovine Albumin (partial sequence)"
bsa.identifier = "BSA"
alb = FASTAEntry()
alb.sequence = "MKWVTFISLLFLFSSAYSRGVFRRDAHKSEVAHRFKDLGE"
alb.description = "ALB Human Albumin (partial sequence)"
alb.identifier = "ALB"
entries = [bsa, alb]
f = FASTAFile()
f.store("example.fasta", entries)
Afterwards, the protein sequences can be read again using:
from pyopenms import *
entries = []
f = FASTAFile()
f.load("example.fasta", entries)
print( len(entries) )
for e in entries:
print (e.identifier, e.sequence)
TheoreticalSpectrumGenerator¶
This class implements a simple generator which generates tandem MS spectra from a given peptide charge combination. There are various options which influence the occurring ions and their intensities.
from pyopenms import *
tsg = TheoreticalSpectrumGenerator()
spec1 = MSSpectrum()
spec2 = MSSpectrum()
peptide = AASequence.fromString("DFPIANGER")
# standard behavior is adding b- and y-ions of charge 1
p = Param()
p.setValue(b"add_b_ions", b"false", b"Add peaks of b-ions to the spectrum")
tsg.setParameters(p)
tsg.getSpectrum(spec1, peptide, 1, 1)
p.setValue(b"add_b_ions", b"true", b"Add peaks of a-ions to the spectrum")
p.setValue(b"add_metainfo", b"true", "")
tsg.setParameters(p)
tsg.getSpectrum(spec2, peptide, 1, 2)
print("Spectrum 1 has", spec1.size(), "peaks.")
print("Spectrum 2 has", spec2.size(), "peaks.")
# Iterate over annotated ions and their masses
for ion, peak in zip(spec2.getStringDataArrays()[0], spec2):
print(ion, peak.getMZ())
which outputs:
Spectrum 1 has 8 peaks.
Spectrum 2 has 30 peaks.
y1++ 88.0631146901
b2++ 132.05495569
y2++ 152.584411802
y1+ 175.118952913
[...]
The example shows how to put peaks of a certain type, y-ions in this case, into
a spectrum. Spectrum 2 is filled with a complete spectrum of all peaks (a-, b-,
y-ions and losses). The TheoreticalSpectrumGenerator has many parameters
which have a detailed description located in the class documentation. For the
first spectrum, no b ions are added. Note how the add_metainfo parameter
in the second example populates the StringDataArray of the output
spectrum, allowing us to iterate over annotated ions and their masses.